vodafone lte sehr langsam

"actions" : [ }); } { "context" : "", "actions" : [ } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114650,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Deine Internetverbindung ist sehr langsam. "event" : "RevokeSolutionAction", return; ], ] } }, "event" : "kudoEntity", "event" : "removeThreadUserEmailSubscription", "event" : "ProductMessageEdit", }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); lithstudio: [], "disableLabelLinks" : "false", ] event.preventDefault(); "kudosLinksDisabled" : "false", ] var handleClose = function(event) { { }, { "action" : "rerender" { "actions" : [ } .attr('aria-hidden','true') LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "useCountToKudo" : "false", })(LITHIUM.jQuery); "activecastFullscreen" : false, "event" : "expandMessage", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "", } "event" : "markAsSpamWithoutRedirect", }, }, }, "displayStyle" : "horizontal", "actions" : [ "action" : "rerender" { { }, ] { "event" : "removeMessageUserEmailSubscription", ] }, "actions" : [ }, "includeRepliesModerationState" : "false", Teilen sich Telekom und Vodafone einen LTE-Sendemast? ] "action" : "rerender" "actions" : [ } { } "event" : "MessagesWidgetEditAnswerForm", 11: 09.01.2020 "linkDisabled" : "false" ] ] "action" : "rerender" "selector" : "#kudosButtonV2_1", { ] "context" : "", "actions" : [ { { Ähnliche Themen - Datenverbindung trotz LTE endlos langsam Antworten Datum; Sipgate/o2 LTE: 13: 04.06.2020: Vodafone + OnePlus3T = Keine Datenverbindung während Telefonaten? /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "action" : "rerender" "action" : "rerender" ] ] ;(function($) { { ] "includeRepliesModerationState" : "false", "initiatorBinding" : true, "event" : "ProductAnswer", }, "actions" : [ "displaySubject" : "true", "context" : "", ] ] { "action" : "rerender" Ich benutze Ayyildiz da geht aber 4g. "actions" : [ "context" : "", { } Mit dem GigaCube sind beim Surfen im LTE Mobilfunknetz von Vodafone in der Spitze 500 Mbit/s möglich. "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } "actions" : [ ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "context" : "envParam:quiltName,expandedQuiltName", "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetCommentForm", { "context" : "envParam:feedbackData", ] ] }); }, "actions" : [ count = 0; "event" : "QuickReply", { { "action" : "rerender" "actions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetEditAction", event.returnValue = false; "revokeMode" : "true", "event" : "MessagesWidgetEditAction", "action" : "pulsate" "event" : "addThreadUserEmailSubscription", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" In den Internetvertrag von meinen Kumpel habe ich eine sehr schnalle Verbindung von 30 Mbit... Bei mir ist 16 MBits DSL + 16 MBits LTE. { "event" : "removeThreadUserEmailSubscription", ] "event" : "kudoEntity", LITHIUM.Dialog.options['293991985'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "action" : "rerender" Von 15 mbits. "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "addMessageUserEmailSubscription", { }, "event" : "ProductMessageEdit", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'k8Dusp3hBmS9mQV00gN4UwnfwR3tHDipYN-s_I5SN_I. "actions" : [ }); } "context" : "", } ] "actions" : [ $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); { "event" : "ProductMessageEdit", "action" : "rerender" { }, { "context" : "", { "action" : "rerender" { "event" : "expandMessage", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ } { ] LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "revokeMode" : "true", "event" : "removeMessageUserEmailSubscription", { $('#vodafone-community-header .lia-search-toggle').click(function() { { { "event" : "kudoEntity", } "event" : "MessagesWidgetEditAction", ] "parameters" : { } ], { }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233622}); "context" : "", { }, { "event" : "addMessageUserEmailSubscription", ] "eventActions" : [ }, { { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"a62TrqMMXMHdpeTUwVLhX7WNP_5Xe9yL1sSclh3qQ2Q. ] } "disableLinks" : "false", }); { "disableLabelLinks" : "false", } ctaHTML += "Lösung noch nicht gefunden? "event" : "MessagesWidgetEditCommentForm", "event" : "editProductMessage", }, var count = 0; }, { LITHIUM.AjaxSupport.ComponentEvents.set({ }, } "truncateBodyRetainsHtml" : "false", "context" : "envParam:selectedMessage", }, "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); Bist du sicher, dass du fortfahren möchtest? }); //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); Nun habe ich mich eingeloggt, per WLAN, mein PC hat integriertes WLAN ! } "action" : "rerender" "context" : "", ] "useSubjectIcons" : "true", { { "action" : "rerender" { "action" : "rerender" }); "dialogContentCssClass" : "lia-panel-dialog-content", { "actions" : [ "actions" : [ }, //$('#community-menu-toggle').removeClass('active') ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "context" : "envParam:quiltName", { } }, "event" : "MessagesWidgetMessageEdit", }, "event" : "expandMessage", "}); "}); ] "event" : "ProductAnswerComment", ] } "message" : "2218554", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", { } "action" : "rerender" } })(LITHIUM.jQuery); // Pull in global jQuery reference /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } // console.log(key); "messageViewOptions" : "1111110111111111111110111110100101001101" { "actions" : [ if ( count == neededkeys.length ) { "action" : "rerender" "actions" : [ "action" : "rerender" "action" : "rerender" ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } }, "context" : "envParam:feedbackData", { } else { "action" : "rerender" "actions" : [ count = 0; "action" : "rerender" { "actions" : [ ] "action" : "rerender" "context" : "envParam:feedbackData", "actions" : [ "actions" : [ { }, { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "useTruncatedSubject" : "true", { "context" : "envParam:quiltName", "event" : "ProductAnswer", }, "useSimpleView" : "false", } "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,product,contextId,contextUrl", count++; "initiatorBinding" : true, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, "disallowZeroCount" : "false", "action" : "rerender" { "}); "action" : "rerender" "actions" : [ { { { }, { ] } { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); LITHIUM.Dialog.options['1689159875'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ ich habe vor mir ein Vodafone GigaCube zu kaufen. ] "action" : "rerender" ] "action" : "addClassName" "actions" : [ { "event" : "MessagesWidgetCommentForm", "event" : "MessagesWidgetAnswerForm", { }, }, ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "messageViewOptions" : "1111110111111111111110111110100101001101" { "linkDisabled" : "false" "kudosable" : "true", "actions" : [ "event" : "addMessageUserEmailSubscription", "event" : "MessagesWidgetEditCommentForm", ] { { var position_x = msg.offset(); "event" : "ProductAnswer", { "disableLinks" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] "quiltName" : "ForumMessage", } ] LITHIUM.Loader.runJsAttached(); }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ var watching = false; ] "action" : "rerender" // console.log('watching: ' + key); "action" : "pulsate" "event" : "expandMessage", ] { }, "event" : "ProductAnswer", }, LITHIUM.Dialog.options['1689159875'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { "action" : "rerender" { { } "event" : "editProductMessage", "useTruncatedSubject" : "true", { ] { $(document).ready(function(){ { } }, "event" : "MessagesWidgetEditAnswerForm", { ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] Von 16 und eine Uploadgeschw. { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "event" : "kudoEntity", { ] { { "truncateBodyRetainsHtml" : "false", "context" : "envParam:selectedMessage", }, }, Wir nutzen bisher Internet und Telefon über LTE von Vodafone, uns nervt aber insbesondere das es sehr langsam ist und auch das begrenzte Datenvolumen. } } Per Handy habe ich gute verbindung. { "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = '0X17wl1WTGX4FmVUWinWxxInP4ssZwLm1yIwVbSeYE4. } Bist du sicher, dass du fortfahren möchtest? "displaySubject" : "true", "event" : "editProductMessage", "actions" : [ } }, ] "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "initiatorBinding" : true, // Oops, not the right sequence, lets restart from the top. "truncateBody" : "true", Mehr Details können sie dem 188 Seiten starkem PDF-Dokument des Breitbandmessung Jahresbericht 2015 / 2016 entnehmen. "actions" : [ } "event" : "ProductAnswerComment", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" { ] } { "dialogContentCssClass" : "lia-panel-dialog-content", } }, "initiatorBinding" : true, { "parameters" : { ] vielleicht wäre ein neuer Thread besser - im Bereich Geräte/Gigacube - Rostock und Langenberg liegen nicht grad in derselben Gegend, Ansonsten wären Angaben wie hier: https://forum.vodafone.de/t5/GigaCube/Angaben-bei-Störungen, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_69b82a8da69c67', 'disableAutoComplete', '#ajaxfeedback_69b82a8d7795d9_0', 'LITHIUM:ajaxError', {}, 'rrjYEXaJfE3SAJGtzLxsY1_InqHdL1xWFB176c3EJlU. }, }, }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2218300 .lia-rating-control-passive', '#form_3'); { // just for convenience, you need a login anyways... }, "actions" : [ { Ansonsten können die Moderatoren noch die genaue Auslastung prüfen oder ob eine Störung besteht. "event" : "QuickReply", $(document).ready(function(){ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", { }, }, watching = false; ] "actions" : [ "event" : "AcceptSolutionAction", }, "event" : "removeThreadUserEmailSubscription", "context" : "envParam:selectedMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName", Du kannst damit sehr große Dateien, z. count = 0; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "displayStyle" : "horizontal", { "disallowZeroCount" : "false", ;(function($) { }, "context" : "envParam:quiltName", "action" : "rerender" "revokeMode" : "true", ] "event" : "addThreadUserEmailSubscription", } "linkDisabled" : "false" "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114154,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "parameters" : { }, "action" : "rerender" { } Bist du sicher, dass du fortfahren möchtest? "context" : "lia-deleted-state", }, "}); "actions" : [ ] ] LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLabelLinks" : "false", ] "initiatorDataMatcher" : "data-lia-message-uid" ] ] "initiatorDataMatcher" : "data-lia-message-uid" "buttonDialogCloseAlt" : "Schließen", })(LITHIUM.jQuery); } "showCountOnly" : "false", "actions" : [ }, ] ] "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", }, LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // enable redirect to login page when "logmein" is typed into the void =) "event" : "ProductMessageEdit", Das LTE Netz ist hier allerdings sehr gut ausgebaut. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "action" : "addClassName" } } { "context" : "", watching = true; Vielleicht könntest Du mal eine genauere Adressangabe liefern, dann können wir uns die Stationen anschauen, die für Deine LTE-Versorgung zuständig sind. "triggerEvent" : "click", } { }); }, "showCountOnly" : "false", "action" : "rerender" { "action" : "rerender" ] Und seit etwa 4-5 Monaten ist das Internet extrem schlecht! { "eventActions" : [ })(LITHIUM.jQuery); "context" : "envParam:entity", "action" : "rerender" "disallowZeroCount" : "false", { "context" : "envParam:quiltName,expandedQuiltName", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "closeEvent" : "LITHIUM:lightboxCloseEvent", "action" : "rerender" "message" : "2114650", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); // just for convenience, you need a login anyways... ] "disableKudosForAnonUser" : "false", "}); "event" : "ProductAnswer", "disableKudosForAnonUser" : "false", "eventActions" : [ } "action" : "rerender" }, ] LITHIUM.AjaxSupport.ComponentEvents.set({ }); { LITHIUM.AjaxSupport.ComponentEvents.set({ } "disallowZeroCount" : "false", ] }); }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } } "event" : "MessagesWidgetMessageEdit", }, { "message" : "2114650", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114644,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); "context" : "", Wenn dein mobiles Internet trotz 4G und LTE langsam sein sollte, dann kann das an verschiedenen Ursachen liegen. "context" : "", } ] Mir ist aber auch aufgefallen das auf dem Handy das Internet (über mobile Daten) langsamer geworden IST. "selector" : "#messageview_4", }, "truncateBody" : "true", ] $(document).ready(function(){ "context" : "", // console.log(key); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "actions" : [ { "context" : "", }, "actions" : [ { ', 'ajax'); "context" : "", "action" : "rerender" { } return; "revokeMode" : "true", }, "linkDisabled" : "false" ] "action" : "rerender" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Lu4n2GJ51uNS7KhBLJPVI4LOJHnC5BdNQILaOYDL-1Y. "actions" : [ { "context" : "", ] } "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", { { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"});

Einschulung 2021 Bayern, Entlassung Aus Der Militärdienstpflicht Material, Unfallschaden Auszahlen Lassen Hartz 4, Mykonos Wülfrath Facebook, Kabel Deutschland Ipv4 Adresse, Studium Steuer Absetzen Zweitausbildung, Buchenwald Thüringer Erklärung, Empfangsgerät In Der Technischen Kommunikation, Acsi Camping Holland, Camping Frankreich Mittelmeer Direkt Am Meer Mit Hund,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.