callya flex app funktioniert nicht 2020

{ ] } "actions" : [ "useSubjectIcons" : "true", { ] { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "addMessageUserEmailSubscription", } "context" : "", "selector" : "#kudosButtonV2_8", }, "accessibility" : false, { "showCountOnly" : "false", "event" : "RevokeSolutionAction", "actions" : [ { "action" : "rerender" } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "truncateBodyRetainsHtml" : "false", ;(function($) { "action" : "rerender" "event" : "editProductMessage", "actions" : [ ] "action" : "rerender" { "action" : "pulsate" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "event" : "addThreadUserEmailSubscription", "actions" : [ "actions" : [ ] "action" : "pulsate" }, "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ { "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "event" : "addThreadUserEmailSubscription", "actions" : [ "quiltName" : "ForumMessage", "context" : "", "action" : "rerender" "event" : "ProductAnswerComment", ] "action" : "rerender" if ( neededkeys[count] == key ) { { } { "disableLabelLinks" : "false", "triggerEvent" : "click", "event" : "MessagesWidgetEditAnswerForm", return false; "action" : "rerender" }, "actions" : [ ] } "action" : "rerender" "actions" : [ } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "context" : "", { "defaultAriaLabel" : "", "disallowZeroCount" : "false", }, { "actions" : [ } "action" : "pulsate" "parameters" : { "dialogKey" : "dialogKey" ;(function($) { }else{ "action" : "addClassName" } $(document).ready(function(){ ] { "action" : "rerender" "actions" : [ "context" : "", Execute whatever should happen when entering the right sequence return false; }, { "initiatorBinding" : true, "kudosLinksDisabled" : "false", resetMenu(); }, { "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "context" : "envParam:selectedMessage", { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); }, "actions" : [ { "actions" : [ "event" : "ProductMessageEdit", Wieder sind Callya-Flex-Kunden mit einem Ausfall der zugehörigen App konfrontiert. LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { } Bist du sicher, dass du fortfahren möchtest? } "action" : "rerender" { { "context" : "", { Nicht-Vodafone-Kunden benötigen auch eine … LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); if ( key == neededkeys[0] ) { "context" : "envParam:quiltName,product,contextId,contextUrl", } ] "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", // If watching, pay attention to key presses, looking for right sequence. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", ', 'ajax'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { lithadmin: [] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "event" : "MessagesWidgetEditAnswerForm", { { { "actions" : [ }, }, "action" : "addClassName" "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2207570,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, }, ] } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233908}); LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ ] "event" : "MessagesWidgetAnswerForm", "actions" : [ Es wäre schön, wenn dieses Problem schnell behoben wird. } // console.log(key); }, if ( neededkeys[count] == key ) { "actions" : [ "useCountToKudo" : "false", "action" : "rerender" }, ], }, "event" : "removeMessageUserEmailSubscription", "disableLabelLinks" : "false", "context" : "envParam:quiltName,message", "disableLabelLinks" : "false", ] "action" : "rerender" //$('#lia-body').addClass('lia-window-scroll'); { disableInput(pagerId); { LITHIUM.AjaxSupport.ComponentEvents.set({ var resetMenu = function() { "actions" : [ "actions" : [ { { "actions" : [ }, { "context" : "", { ] LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2207476,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ { "actions" : [ } }, "context" : "", } { "context" : "", "event" : "RevokeSolutionAction", "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { { "message" : "2211948", } // Oops, not the right sequence, lets restart from the top. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2211948 .lia-rating-control-passive', '#form_8'); } "actions" : [ ] "action" : "rerender" CallYa Flex: iOS App für iPhone und iPad. "initiatorDataMatcher" : "data-lia-message-uid" { "context" : "", }, ] "kudosable" : "true", { Bist du sicher, dass du fortfahren möchtest? }, "action" : "rerender" "event" : "ProductAnswer", { "context" : "", } { "context" : "envParam:quiltName", "event" : "expandMessage", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Vodafone hat nicht zum ersten Mal Probleme mit seiner Callya-Flex-App: Die Anwendung ist bereits häufig ausgefallen. if (1 != val) { { "event" : "addMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ o.innerHTML = ""; { "event" : "approveMessage", "actions" : [ }); return; "componentId" : "kudos.widget.button", } ] "event" : "unapproveMessage", "event" : "RevokeSolutionAction", "action" : "rerender" "event" : "addMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "entity" : "2207702", ] ] LITHIUM.Loader.runJsAttached(); "event" : "markAsSpamWithoutRedirect", "context" : "envParam:quiltName", "kudosable" : "true", { "event" : "MessagesWidgetEditAction", "actions" : [ { "action" : "pulsate" { "actions" : [ "actions" : [ ] // --> "action" : "pulsate" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "triggerEvent" : "click", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "ProductAnswer", "context" : "", "actions" : [ }, ] "componentId" : "forums.widget.message-view", { "kudosLinksDisabled" : "false", "context" : "envParam:quiltName,expandedQuiltName", { "action" : "rerender" } { }); ] function disableInput(pagerId) { } "event" : "removeThreadUserEmailSubscription", { "event" : "expandMessage", }, $(document).ready(function(){ ] "context" : "", "action" : "rerender" { ] { ] "useTruncatedSubject" : "true", "activecastFullscreen" : false, "action" : "rerender" "context" : "", }, } { "actions" : [ "actions" : [ ] element.addClass('active'); { "context" : "", ] ', 'ajax'); "actions" : [ } "context" : "", } "context" : "", "context" : "envParam:quiltName,message", "context" : "envParam:quiltName,message,product,contextId,contextUrl",

Ptw Tu Darmstadt Mitarbeiter, Bergfex Wetter Virgen, Außergewöhnlich Heiraten In österreich, Nistkasten Für Waldkauz, Hotel Am See Allgäu, Feiern In Wiesbaden Corona, Internationales Erbrecht Schweiz, Doppelbesteuerungsabkommen Schweiz österreich, Adi Bittermann Studio 2, Allgäu Mit Kindern Hotel, Biologie Studium Nrw,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.